PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G76580.1
Common NameF14G6.18, SPL16, SPL1R3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 988aa    MW: 109849 Da    PI: 8.5712
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G76580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.1e-4082158278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  Cqv++C++dls ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk+q+
  AT1G76580.1  82 CQVDNCKEDLSIAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLDGHNRRRRKTQP 158
                  **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-3374143IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.75279156IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-3780161IPR004333Transcription factor, SBP-box
PfamPF031101.4E-2882155IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.59E-6789882IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.208.9E-5789880IPR020683Ankyrin repeat-containing domain
CDDcd002042.82E-4792879No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 988 aa     Download sequence    Send to blast
MGELPKDDWQ MNRWKWDGQR FEAIELQGES LQLSNKKGLD LNLPCGFNDV EGTPVDLTRP  60
SKKVRSGSPG SGGGGGGNYP KCQVDNCKED LSIAKDYHRR HKVCEVHSKA TKALVGKQMQ  120
RFCQQCSRFH LLSEFDEGKR SCRRRLDGHN RRRRKTQPDA ITSQVVALEN RDNTSNNTNM  180
DVMALLTALV CAQGRNEATT NGSPGVPQRE QLLQILNKIK ALPLPMNLTS KLNNIGILAR  240
KNPEQPSPMN PQNSMNGASS PSTMDLLAAL SASLGSSAPE AIAFLSQGGF GNKESNDRTK  300
LTSSDHSATT SLEKKTLEFP SFGGGERTSS TNHSPSQYSD SRGQDTRSSL SLQLFTSSPE  360
EESRPKVASS TKYYSSASSN PVEDRSPSSS PVMQELFPLH TSPETRRYNN YKDTSTSPRT  420
SCLPLELFGA SNRGATANPN YNVLRHQSGY ASSGSDYSPP SLNSNAQERT GKISFKLFEK  480
DPSQLPNTLR TEIFRWLSSF PSDMESFIRP GCVILSVYVA MSASAWEQLE ENLLQRVRSL  540
VQDSEFWSNS RFLVNAGRQL ASHKHGRIRL SKSWRTLNLP ELITVSPLAV VAGEETALIV  600
RGRNLTNDGM RLRCAHMGNY ASMEVTGREH RLTKVDELNV SSFQVQSASS VSLGRCFIEL  660
ENGLRGDNFP LIIANATICK ELNRLEEEFH PKDVIEEQIQ NLDRPRSREE VLCFLNELGW  720
LFQRKWTSDI HGEPDFSLPR FKFLLVCSVE RDYCSLIRTV LDMMVERNLG KDGLLNKESL  780
DMLADIQLLN RAIKRRNTKM AETLIHYSVN PSTRNFIFLP SIAGPGDITP LHLAASTSSS  840
DDMIDALTND PQEIGLSCWN TLVDATGQTP FSYAAMRDNH SYNTLVARKL ADKRNGQISL  900
NIENGIDQIG LSKRLSSELK RSCNTCASVA LKYQRKVSGS RRLFPTPIIH SMLAVATVCV  960
CVCVFMHAFP MVRQGSHFSW GGLDYGSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-2967155184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1790795RAIKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5040.0cell culture| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2402543790.0
Genevisible259971_at0.0
Expression AtlasAT1G76580-
AtGenExpressAT1G76580-
ATTED-IIAT1G76580-
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G76580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G76580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0626700.0AY062670.1 Arabidopsis thaliana Unknown protein (At1g76580; F14G6.18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177784.60.0squamosa promoter-binding-like protein 16
SwissprotQ700C20.0SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBLD7KTV10.0D7KTV1_ARALL; Putative uncharacterized protein
STRINGAT1G76580.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39992554
Representative plantOGRP71381115
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  6. Vogel JT,Zarka DG,Van Buskirk HA,Fowler SG,Thomashow MF
    Roles of the CBF2 and ZAT12 transcription factors in configuring the low temperature transcriptome of Arabidopsis.
    Plant J., 2005. 41(2): p. 195-211
    [PMID:15634197]
  7. Lee BH,Henderson DA,Zhu JK
    The Arabidopsis cold-responsive transcriptome and its regulation by ICE1.
    Plant Cell, 2005. 17(11): p. 3155-75
    [PMID:16214899]
  8. Benschop JJ, et al.
    Quantitative phosphoproteomics of early elicitor signaling in Arabidopsis.
    Mol. Cell Proteomics, 2007. 6(7): p. 1198-214
    [PMID:17317660]
  9. Guo AY, et al.
    Genome-wide identification and evolutionary analysis of the plant specific SBP-box transcription factor family.
    Gene, 2008. 418(1-2): p. 1-8
    [PMID:18495384]
  10. Huang D,Wu W,Abrams SR,Cutler AJ
    The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors.
    J. Exp. Bot., 2008. 59(11): p. 2991-3007
    [PMID:18552355]
  11. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]